Nitrogenous organic acid comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-01-05. Numbers and descriptions here follow the published literature rather than marketing material.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
In aqueous solution, creatine monohydrate exists mainly as a zwitterion, carrying both a positive guanidinium charge and a negative carboxylate charge. This charge separation raises water solubility relative to many neutral organic solids and helps explain its behavior in analytical separations. The monohydrate can lose its water of crystallization under sustained heat or low humidity, converting toward anhydrous creatine. Such transitions matter for mass balance calculations because the hydrate contributes water mass that is not part of the active creatine molecule.
The term creatine monohydrate is often shortened to creatine in casual usage, though other creatine forms exist, including citrate, nitrate, and hydrochloride salts. These alternative forms differ in solubility, pH behavior, and the amount of creatine delivered per unit mass. Regulatory categories vary by country: some jurisdictions treat it as a food ingredient, while others place it under supplement or drug frameworks depending on claims and presentation. Standard reference texts list it as a naturally occurring nitrogenous organic acid rather than a vitamin or mineral.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H9N3O2·H2O | Monohydrate form; anhydrous is C4H9N3O2 |
| Molar mass | 149.15 g/mol | For the monohydrate |
| Appearance | White crystalline powder | Odorless, slightly bitter taste |
| Solubility in water | ~13 g/L at 25 °C | Poorly soluble; increases with temperature |
| CAS Registry Number | 6020-87-7 | For creatine monohydrate |
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The Wnt signaling pathway can be divided in canonical and non-canonical. The canonical signaling involves binding of Wnt to Frizzled and LRP5 co-receptor, leading to GSK3 phosphorylation and inhibition of β-catenin degradation, resulting in its accumulation and translocation to the nucleus, where it acts as a transcription factor. The non-canonical Wnt signaling can be divided in planar cell polarity (PCP) pathway and Wnt/calcium pathway. It is characterized by binding of Wnt to Frizzled and activation of G proteins and to an increase of intracellular levels of calcium through mechanisms involving PKC 50. The Wnt signaling pathway plays a significant role in osteoblastogenesis and bone formation, inducing the differentiation of mesenquimal pluripotent cells in osteoblasts and inhibiting the RANKL/RANK pathway and osteoclastogenesis.
Sources: en.wikipedia.org
While the initial consolidation of Air Force laboratories reduced overhead and budgetary pressure, another push towards a unified laboratory structure came in the form of the National Defense Authorization Act for Fiscal Year 1996, Section 277. This section instructed the Department of Defense to produce a five-year plan for consolidation and restructuring of all defense laboratories. The currently existing laboratory structure was created in October 1997 through the consolidation of Phillips Laboratory headquartered in Albuquerque, New Mexico, Wright Laboratory in Dayton, Ohio, Rome Laboratory (formerly Rome Air Development Center) in Rome, New York, and Armstrong Laboratory in San Antonio, Texas and the Air Force Office of Scientific Research (AFOSR). The single laboratory concept was developed and championed by Maj Gen Richard Paul, who was Director of Science & Technology for AFMC and Gen Henry Viccellio Jr, and then became the first Commander of AFRL.
3-Dehydrocarnitine has a role as a human metabolite, as it is an intermediate of the degradation of carnitine. Carnitine is utilized in the transport of fatty acids from the cytosol into the mitochondria of living cells during the breakdown of fatty acids for the generation of metabolic energy. In humans, 3-dehydrocarnitine is found in the blood, saliva, urine, and feces. In patients with colorectal cancer, elevated levels of 3-dehydrocarnitine have been detected, possibly due to the elevated rate of metabolism seen in malignant cancer cells. 3-Dehydrocarnitine is also found exogenously in multiple sources of food, such as poultry, lagomorph, sheep, goat, beef, venison, equine, and pork. This indicates its presence in the animals the food is derived from. 3-Dehydrocarnitine is also present in mice and Apis cerana. It is found as a metabolite in aging mouse brains, and is found as a product of Apis cerana.
The HIE-ISOLDE project introduced a network of High Energy Beam Transfer (HEBT) beamlines to the ISOLDE facility. The common section beamline, XT00, joins to three bending beamlines (XT01, XT02, XT03) leading to different experiment setups. The three identical beamlines are independent of each other, for example, if the first XT01 dipole magnet is off, the beam will continue to the XT02 and XT03. They all bend the beam by 90 degrees and focus it using two dipole magnets and a doublet-quadrupole. The XT01 beamline leads to Miniball, the XT02 beamline leads to the ISS, and the XT03 beamline leads to movable setups, such as the SEC scattering chamber. Offline 2 was recently installed as a mass separator beamline at ISOLDE, with the purpose of satisfying the increased demands on the original offline facility, Offline 1. The facility includes the beamline enclosed in a Faraday cage as well as a laser laboratory and control station. The offline facility is designed for target test studies, and upgraded to include potential for the production and study of molecular ion beams.
Sources: en.wikipedia.org
It is a compound made of creatine bound to one water molecule. It appears as a white crystalline powder and is the most common solid form of creatine used in research and supplements.
Creatine is converted to phosphocreatine in muscle, which helps regenerate adenosine triphosphate during brief, high-intensity activity. The body also obtains creatine from foods such as meat and fish.
The creatine molecule is the same whether from food or supplements, but the monohydrate form includes a water molecule in its crystal structure. Once dissolved, the monohydrate and food-derived creatine are chemically identical in the body.
In common usage, yes, but technically creatine monohydrate is one specific hydrated salt form. Other creatine forms exist and differ in composition and properties. The monohydrate is the most studied and most widely available grade.